- Sponsor
-
Notifications
You must be signed in to change notification settings - Fork 73
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
* added a couple of example functions to io_test.go. * added Gff IO example tests. * added gbk IO example tests. * added JSON IO example tests. * refactored parse functions to accept bytes instead of strings. * adding sample json file for testing. * added example tests for primer functions. * make complementBaseRuneMap private. * made defaultCodonTable maps private. * made getCodonFrequency private. * recommented BoothLeastRotation. * added example test to hash_test.go. * modified RotateSequence and made boothLeastRotation private. * added example tests to translation_test.go.
- v0.31.2
- v0.31.1
- v0.31.0
- v0.30.0
- v0.29.2
- v0.29.1
- v0.29.0
- v0.28.0
- v0.27.2
- v0.27.1
- v0.27.0
- v0.26.0
- v0.25.2
- v0.25.1
- v0.25.0
- v0.24.0
- v0.23.0
- v0.22.2
- v0.22.1
- v0.22.0
- v0.21.2
- v0.21.1
- v0.21.0
- v0.20.0
- v0.19.0
- v0.18.0
- v0.17.1
- v0.17.0
- v0.16.1
- v0.16.0
- v0.15.0
- v0.14.0
- v0.13.7
- v0.13.6
- v0.13.5
- v0.13.4
- v0.13.3
- v0.13.2
- v0.13.1
- v0.13.0
- v0.12.0
- v0.11.1
- v0.11.0
- v0.10.0
- v0.9.0
- v0.8.1
- v0.7.1
- v0.6.1
- v0.6.0
- v0.5.0
- nightly
1 parent
67bc453
commit 9cd47eb
Showing
12 changed files
with
423 additions
and
46 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,193 @@ | ||
{ | ||
"Meta": { | ||
"Name": "", | ||
"GffVersion": "", | ||
"RegionStart": 0, | ||
"RegionEnd": 0, | ||
"Size": 0, | ||
"Type": "", | ||
"GenbankDivision": "", | ||
"Date": "", | ||
"Definition": "Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds.", | ||
"Accession": "U49845", | ||
"Version": "U49845.1 GI:1293613", | ||
"Keywords": ".", | ||
"Organism": "Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.", | ||
"Source": "Saccharomyces cerevisiae (baker's yeast)", | ||
"Origin": "", | ||
"Locus": { | ||
"Name": "SCU49845", | ||
"SequenceLength": "5028", | ||
"MoleculeType": "DNA", | ||
"GenBankDivision": "PLN", | ||
"ModDate": "21-JUN-1999", | ||
"SequenceCoding": "bp", | ||
"Circular": false | ||
}, | ||
"References": [ | ||
{ | ||
"Index": "1", | ||
"Authors": "Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W.", | ||
"Title": "Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae", | ||
"Journal": "Yeast 10 (11), 1503-1509 (1994)", | ||
"PubMed": "7871890", | ||
"Remark": "", | ||
"Range": "(bases 1 to 5028)" | ||
}, | ||
{ | ||
"Index": "2", | ||
"Authors": "Roemer,T., Madden,K., Chang,J. and Snyder,M.", | ||
"Title": "Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein", | ||
"Journal": "Genes Dev. 10 (7), 777-793 (1996)", | ||
"PubMed": "8846915", | ||
"Remark": "", | ||
"Range": "(bases 1 to 5028)" | ||
}, | ||
{ | ||
"Index": "3", | ||
"Authors": "Roemer,T.", | ||
"Title": "Direct Submission", | ||
"Journal": "Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USA", | ||
"PubMed": "", | ||
"Remark": "", | ||
"Range": "(bases 1 to 5028)" | ||
} | ||
], | ||
"Primaries": null | ||
}, | ||
"Features": [ | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "source", | ||
"Start": 1, | ||
"End": 5028, | ||
"Complement": false, | ||
"FivePrimePartial": false, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"chromosome": "IX", | ||
"db_xref": "taxon:4932", | ||
"map": "9", | ||
"organism": "Saccharomyces cerevisiae" | ||
}, | ||
"Location": "1..5028", | ||
"Sequence": "" | ||
}, | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "CDS", | ||
"Start": 1, | ||
"End": 206, | ||
"Complement": false, | ||
"FivePrimePartial": true, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"codon_start": "3", | ||
"db_xref": "GI:1293614", | ||
"product": "TCP1-beta", | ||
"protein_id": "AAA98665.1", | ||
"translation": "SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARPRTANRQHM" | ||
}, | ||
"Location": "\u003c1..206", | ||
"Sequence": "" | ||
}, | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "gene", | ||
"Start": 687, | ||
"End": 3158, | ||
"Complement": false, | ||
"FivePrimePartial": false, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"gene": "AXL2" | ||
}, | ||
"Location": "687..3158", | ||
"Sequence": "" | ||
}, | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "CDS", | ||
"Start": 687, | ||
"End": 3158, | ||
"Complement": false, | ||
"FivePrimePartial": false, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"codon_start": "1", | ||
"db_xref": "GI:1293615", | ||
"function": "required for axial budding pattern of S.cerevisiae", | ||
"gene": "AXL2", | ||
"note": "plasma membrane glycoprotein", | ||
"product": "Axl2p", | ||
"protein_id": "AAA98666.1", | ||
"translation": "MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESFTFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFNVILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNEVFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPETSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYVYLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYGDVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQDHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSANATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIACGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLNNPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQSQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDSYGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTKHRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRLVDFSNKSNVNVGQVKDIHGRIPEML" | ||
}, | ||
"Location": "687..3158", | ||
"Sequence": "" | ||
}, | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "gene", | ||
"Start": 3300, | ||
"End": 4037, | ||
"Complement": true, | ||
"FivePrimePartial": false, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"gene": "REV7" | ||
}, | ||
"Location": "complement(3300..4037)", | ||
"Sequence": "" | ||
}, | ||
{ | ||
"Name": "", | ||
"Source": "", | ||
"Type": "CDS", | ||
"Start": 3300, | ||
"End": 4037, | ||
"Complement": true, | ||
"FivePrimePartial": false, | ||
"ThreePrimePartial": false, | ||
"Score": "", | ||
"Strand": "", | ||
"Phase": "", | ||
"Attributes": { | ||
"codon_start": "1", | ||
"db_xref": "GI:1293616", | ||
"gene": "REV7", | ||
"product": "Rev7p", | ||
"protein_id": "AAA98667.1", | ||
"translation": "MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQFVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVDKDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNRRVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEKLISGDDKILNGVYSQYEEGESIFGSLF" | ||
}, | ||
"Location": "complement(3300..4037)", | ||
"Sequence": "" | ||
} | ||
], | ||
"Sequence": { | ||
"Description": "", | ||
"Hash": "", | ||
"HashFunction": "", | ||
"Sequence": "gatcctccatatacaacggtatctccacctcaggtttagatctcaacaacggaaccattgccgacatgagacagttaggtatcgtcgagagttacaagctaaaacgagcagtagtcagctctgcatctgaagccgctgaagttctactaagggtggataacatcatccgtgcaagaccaagaaccgccaatagacaacatatgtaacatatttaggatatacctcgaaaataataaaccgccacactgtcattattataattagaaacagaacgcaaaaattatccactatataattcaaagacgcgaaaaaaaaagaacaacgcgtcatagaacttttggcaattcgcgtcacaaataaattttggcaacttatgtttcctcttcgagcagtactcgagccctgtctcaagaatgtaataatacccatcgtaggtatggttaaagatagcatctccacaacctcaaagctccttgccgagagtcgccctcctttgtcgagtaattttcacttttcatatgagaacttattttcttattctttactctcacatcctgtagtgattgacactgcaacagccaccatcactagaagaacagaacaattacttaatagaaaaattatatcttcctcgaaacgatttcctgcttccaacatctacgtatatcaagaagcattcacttaccatgacacagcttcagatttcattattgctgacagctactatatcactactccatctagtagtggccacgccctatgaggcatatcctatcggaaaacaataccccccagtggcaagagtcaatgaatcgtttacatttcaaatttccaatgatacctataaatcgtctgtagacaagacagctcaaataacatacaattgcttcgacttaccgagctggctttcgtttgactctagttctagaacgttctcaggtgaaccttcttctgacttactatctgatgcgaacaccacgttgtatttcaatgtaatactcgagggtacggactctgccgacagcacgtctttgaacaatacataccaatttgttgttacaaaccgtccatccatctcgctatcgtcagatttcaatctattggcgttgttaaaaaactatggttatactaacggcaaaaacgctctgaaactagatcctaatgaagtcttcaacgtgacttttgaccgttcaatgttcactaacgaagaatccattgtgtcgtattacggacgttctcagttgtataatgcgccgttacccaattggctgttcttcgattctggcgagttgaagtttactgggacggcaccggtgataaactcggcgattgctccagaaacaagctacagttttgtcatcatcgctacagacattgaaggattttctgccgttgaggtagaattcgaattagtcatcggggctcaccagttaactacctctattcaaaatagtttgataatcaacgttactgacacaggtaacgtttcatatgacttacctctaaactatgtttatctcgatgacgatcctatttcttctgataaattgggttctataaacttattggatgctccagactgggtggcattagataatgctaccatttccgggtctgtcccagatgaattactcggtaagaactccaatcctgccaatttttctgtgtccatttatgatacttatggtgatgtgatttatttcaacttcgaagttgtctccacaacggatttgtttgccattagttctcttcccaatattaacgctacaaggggtgaatggttctcctactattttttgccttctcagtttacagactacgtgaatacaaacgtttcattagagtttactaattcaagccaagaccatgactgggtgaaattccaatcatctaatttaacattagctggagaagtgcccaagaatttcgacaagctttcattaggtttgaaagcgaaccaaggttcacaatctcaagagctatattttaacatcattggcatggattcaaagataactcactcaaaccacagtgcgaatgcaacgtccacaagaagttctcaccactccacctcaacaagttcttacacatcttctacttacactgcaaaaatttcttctacctccgctgctgctacttcttctgctccagcagcgctgccagcagccaataaaacttcatctcacaataaaaaagcagtagcaattgcgtgcggtgttgctatcccattaggcgttatcctagtagctctcatttgcttcctaatattctggagacgcagaagggaaaatccagacgatgaaaacttaccgcatgctattagtggacctgatttgaataatcctgcaaataaaccaaatcaagaaaacgctacacctttgaacaacccctttgatgatgatgcttcctcgtacgatgatacttcaatagcaagaagattggctgctttgaacactttgaaattggataaccactctgccactgaatctgatatttccagcgtggatgaaaagagagattctctatcaggtatgaatacatacaatgatcagttccaatcccaaagtaaagaagaattattagcaaaacccccagtacagcctccagagagcccgttctttgacccacagaataggtcttcttctgtgtatatggatagtgaaccagcagtaaataaatcctggcgatatactggcaacctgtcaccagtctctgatattgtcagagacagttacggatcacaaaaaactgttgatacagaaaaacttttcgatttagaagcaccagagaaggaaaaacgtacgtcaagggatgtcactatgtcttcactggacccttggaacagcaatattagcccttctcccgtaagaaaatcagtaacaccatcaccatataacgtaacgaagcatcgtaaccgccacttacaaaatattcaagactctcaaagcggtaaaaacggaatcactcccacaacaatgtcaacttcatcttctgacgattttgttccggttaaagatggtgaaaatttttgctgggtccatagcatggaaccagacagaagaccaagtaagaaaaggttagtagatttttcaaataagagtaatgtcaatgttggtcaagttaaggacattcacggacgcatcccagaaatgctgtgattatacgcaacgatattttgcttaattttattttcctgttttattttttattagtggtttacagataccctatattttatttagtttttatacttagagacatttaattttaattccattcttcaaatttcatttttgcacttaaaacaaagatccaaaaatgctctcgccctcttcatattgagaatacactccattcaaaattttgtcgtcaccgctgattaatttttcactaaactgatgaataatcaaaggccccacgtcagaaccgactaaagaagtgagttttattttaggaggttgaaaaccattattgtctggtaaattttcatcttcttgacatttaacccagtttgaatccctttcaatttctgctttttcctccaaactatcgaccctcctgtttctgtccaacttatgtcctagttccaattcgatcgcattaataactgcttcaaatgttattgtgtcatcgttgactttaggtaatttctccaaatgcataatcaaactatttaaggaagatcggaattcgtcgaacacttcagtttccgtaatgatctgatcgtctttatccacatgttgtaattcactaaaatctaaaacgtatttttcaatgcataaatcgttctttttattaataatgcagatggaaaatctgtaaacgtgcgttaatttagaaagaacatccagtataagttcttctatatagtcaattaaagcaggatgcctattaatgggaacgaactgcggcaagttgaatgactggtaagtagtgtagtcgaatgactgaggtgggtatacatttctataaaataaaatcaaattaatgtagcattttaagtataccctcagccacttctctacccatctattcataaagctgacgcaacgattactattttttttttcttcttggatctcagtcgtcgcaaaaacgtataccttctttttccgaccttttttttagctttctggaaaagtttatattagttaaacagggtctagtcttagtgtgaaagctagtggtttcgattgactgatattaagaaagtggaaattaaattagtagtgtagacgtatatgcatatgtatttctcgcctgtttatgtttctacgtacttttgatttatagcaaggggaaaagaaatacatactattttttggtaaaggtgaaagcataatgtaaaagctagaataaaatggacgaaataaagagaggcttagttcatcttttttccaaaaagcacccaatgataataactaaaatgaaaaggatttgccatctgtcagcaacatcagttgtgtgagcaataataaaatcatcacctccgttgcctttagcgcgtttgtcgtttgtatcttccgtaattttagtcttatcaatgggaatcataaattttccaatgaattagcaatttcgtccaattctttttgagcttcttcatatttgctttggaattcttcgcacttcttttcccattcatctctttcttcttccaaagcaacgatccttctacccatttgctcagagttcaaatcggcctctttcagtttatccattgcttccttcagtttggcttcactgtcttctagctgttgttctagatcctggtttttcttggtgtagttctcattattagatctcaagttattggagtcttcagccaattgctttgtatcagacaattgactctctaacttctccacttcactgtcgagttgctcgtttttagcggacaaagatttaatctcgttttctttttcagtgttagattgctctaattctttgagctgttctctcagctcctcatatttttcttgccatgactcagattctaattttaagctattcaatttctctttgatc" | ||
} | ||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters